Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for laurens1311 131. laurens1311 Lv 1 1 pt. 6,634
  2. Avatar for e987 132. e987 Lv 1 1 pt. 6,398
  3. Avatar for pemmer77 133. pemmer77 Lv 1 1 pt. 6,226
  4. Avatar for frostschutz 134. frostschutz Lv 1 1 pt. 6,109
  5. Avatar for richard c 135. richard c Lv 1 1 pt. 6,096
  6. Avatar for komnor 136. komnor Lv 1 1 pt. 5,543
  7. Avatar for zid 137. zid Lv 1 1 pt. 5,460
  8. Avatar for Belle36 138. Belle36 Lv 1 1 pt. 5,368
  9. Avatar for zysiolo 139. zysiolo Lv 1 1 pt. 5,071
  10. Avatar for larry25427 140. larry25427 Lv 1 1 pt. 5,046

Comments