Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805
  1. Avatar for oureion 91. oureion Lv 1 3 pts. 8,487
  2. Avatar for harvardman 92. harvardman Lv 1 2 pts. 8,485
  3. Avatar for fisherlr777 93. fisherlr777 Lv 1 2 pts. 8,465
  4. Avatar for rezaefar 94. rezaefar Lv 1 2 pts. 8,465
  5. Avatar for alwan2018 95. alwan2018 Lv 1 2 pts. 8,464
  6. Avatar for ehhan2018 96. ehhan2018 Lv 1 2 pts. 8,453
  7. Avatar for Knoblerine 97. Knoblerine Lv 1 2 pts. 8,430
  8. Avatar for aspadistra 98. aspadistra Lv 1 2 pts. 8,424
  9. Avatar for xavierhochart 99. xavierhochart Lv 1 2 pts. 8,421
  10. Avatar for johngran 100. johngran Lv 1 2 pts. 8,418

Comments