Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805
  1. Avatar for abiogenesis 101. abiogenesis Lv 1 2 pts. 8,401
  2. Avatar for SouperGenious 102. SouperGenious Lv 1 1 pt. 8,395
  3. Avatar for navn 103. navn Lv 1 1 pt. 8,379
  4. Avatar for Steven Pletsch 104. Steven Pletsch Lv 1 1 pt. 8,373
  5. Avatar for kludbrook 105. kludbrook Lv 1 1 pt. 8,338
  6. Avatar for mthwate 106. mthwate Lv 1 1 pt. 8,314
  7. Avatar for xbp 107. xbp Lv 1 1 pt. 8,310
  8. Avatar for sydlg19 108. sydlg19 Lv 1 1 pt. 8,289
  9. Avatar for rinze 109. rinze Lv 1 1 pt. 8,254
  10. Avatar for RTFGCV 110. RTFGCV Lv 1 1 pt. 8,240

Comments