Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805
  1. Avatar for Altercomp 131. Altercomp Lv 1 1 pt. 7,447
  2. Avatar for SaBig2018 132. SaBig2018 Lv 1 1 pt. 7,419
  3. Avatar for zid 133. zid Lv 1 1 pt. 7,409
  4. Avatar for GazMacca31 134. GazMacca31 Lv 1 1 pt. 7,362
  5. Avatar for borattt 135. borattt Lv 1 1 pt. 7,290
  6. Avatar for viroy2018 136. viroy2018 Lv 1 1 pt. 7,287
  7. Avatar for 01010011111 137. 01010011111 Lv 1 1 pt. 7,280
  8. Avatar for joaniegirl 138. joaniegirl Lv 1 1 pt. 7,236
  9. Avatar for mikim2018 139. mikim2018 Lv 1 1 pt. 7,216
  10. Avatar for komnor 140. komnor Lv 1 1 pt. 7,064

Comments