Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805

  1. Avatar for lamoille 151. lamoille Lv 1 1 pt. 6,605
  2. Avatar for Psych0Active 152. Psych0Active Lv 1 1 pt. 6,559
  3. Avatar for multaq 153. multaq Lv 1 1 pt. 6,508
  4. Avatar for Jakell42 154. Jakell42 Lv 1 1 pt. 6,411
  5. Avatar for Tehnologik1 155. Tehnologik1 Lv 1 1 pt. 6,111
  6. Avatar for CB19Rolf 156. CB19Rolf Lv 1 1 pt. 4,687
  7. Avatar for _nilsson.ac 157. _nilsson.ac Lv 1 1 pt. 1,407
  8. Avatar for DodoBird 159. DodoBird Lv 1 1 pt. 668
  9. Avatar for RAH 160. RAH Lv 1 1 pt. 668

Comments