1620: Revisiting Puzzle 93: Spider Toxin
Closed since about 7 years ago
Novice Overall PredictionSummary
- Created
- January 08, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Top groups
Comments