Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805
  1. Avatar for cbwest 61. cbwest Lv 1 11 pts. 9,231
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 11 pts. 9,216
  3. Avatar for joremen 63. joremen Lv 1 10 pts. 9,149
  4. Avatar for alcor29 64. alcor29 Lv 1 10 pts. 9,114
  5. Avatar for JasperD 65. JasperD Lv 1 9 pts. 9,114
  6. Avatar for WBarme1234 66. WBarme1234 Lv 1 9 pts. 9,106
  7. Avatar for alwen 67. alwen Lv 1 9 pts. 9,106
  8. Avatar for Crossed Sticks 68. Crossed Sticks Lv 1 8 pts. 9,096
  9. Avatar for PlagueRat 69. PlagueRat Lv 1 8 pts. 9,080
  10. Avatar for stomjoh 70. stomjoh Lv 1 7 pts. 9,043

Comments