Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805
  1. Avatar for carsonfb 71. carsonfb Lv 1 7 pts. 9,039
  2. Avatar for vakobo 72. vakobo Lv 1 7 pts. 9,011
  3. Avatar for pfirth 73. pfirth Lv 1 6 pts. 8,881
  4. Avatar for Flagg65a 74. Flagg65a Lv 1 6 pts. 8,870
  5. Avatar for Grom 75. Grom Lv 1 6 pts. 8,836
  6. Avatar for Maerlyn138 76. Maerlyn138 Lv 1 6 pts. 8,803
  7. Avatar for altaris 77. altaris Lv 1 5 pts. 8,790
  8. Avatar for Merf 78. Merf Lv 1 5 pts. 8,786
  9. Avatar for benrh 79. benrh Lv 1 5 pts. 8,776
  10. Avatar for altejoh 80. altejoh Lv 1 5 pts. 8,765

Comments