Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Void Crushers 100 pts. 9,911
  2. Avatar for Go Science 2. Go Science 76 pts. 9,893
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,874
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,866
  5. Avatar for Contenders 5. Contenders 29 pts. 9,779
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,763
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,736
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 9,712
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,675
  10. Avatar for Russian team 10. Russian team 4 pts. 9,663

  1. Avatar for Altercomp 131. Altercomp Lv 1 1 pt. 7,447
  2. Avatar for SaBig2018 132. SaBig2018 Lv 1 1 pt. 7,419
  3. Avatar for zid 133. zid Lv 1 1 pt. 7,409
  4. Avatar for GazMacca31 134. GazMacca31 Lv 1 1 pt. 7,362
  5. Avatar for borattt 135. borattt Lv 1 1 pt. 7,290
  6. Avatar for viroy2018 136. viroy2018 Lv 1 1 pt. 7,287
  7. Avatar for 01010011111 137. 01010011111 Lv 1 1 pt. 7,280
  8. Avatar for joaniegirl 138. joaniegirl Lv 1 1 pt. 7,236
  9. Avatar for mikim2018 139. mikim2018 Lv 1 1 pt. 7,216
  10. Avatar for komnor 140. komnor Lv 1 1 pt. 7,064

Comments