Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Void Crushers 100 pts. 9,911
  2. Avatar for Go Science 2. Go Science 76 pts. 9,893
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,874
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,866
  5. Avatar for Contenders 5. Contenders 29 pts. 9,779
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,763
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,736
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 9,712
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,675
  10. Avatar for Russian team 10. Russian team 4 pts. 9,663

  1. Avatar for mayearly 161. mayearly Lv 1 1 pt. 668
  2. Avatar for peterwashington 162. peterwashington Lv 1 1 pt. 668
  3. Avatar for CB19TAKA 163. CB19TAKA Lv 1 1 pt. 668
  4. Avatar for CB19Hard 164. CB19Hard Lv 1 1 pt. 668
  5. Avatar for CB19PANI 165. CB19PANI Lv 1 1 pt. 668
  6. Avatar for Mike Cassidy 166. Mike Cassidy Lv 1 1 pt. 668
  7. Avatar for hpaege 167. hpaege Lv 1 1 pt. 668
  8. Avatar for Parnikkapore 168. Parnikkapore Lv 1 1 pt. 668

Comments