Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for ZeroLeak7IRC
    1. ZeroLeak7IRC Lv 1
    100 pts. 11,354
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 97 pts. 11,310
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 11,267
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 92 pts. 11,230
  5. Avatar for frood66 5. frood66 Lv 1 89 pts. 11,228
  6. Avatar for Mark- 6. Mark- Lv 1 86 pts. 11,208
  7. Avatar for Susume 7. Susume Lv 1 83 pts. 11,203
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 81 pts. 11,195
  9. Avatar for LociOiling 9. LociOiling Lv 1 78 pts. 11,184
  10. Avatar for isaksson 10. isaksson Lv 1 76 pts. 11,183

Comments