Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for isaksson
    1. isaksson Lv 1
    100 pts. 11,345
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 84 pts. 11,344
  3. Avatar for Hollinas 3. Hollinas Lv 1 70 pts. 11,333
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 57 pts. 11,330
  5. Avatar for Phyx 5. Phyx Lv 1 47 pts. 11,323
  6. Avatar for Maerlyn138 6. Maerlyn138 Lv 1 38 pts. 11,323
  7. Avatar for DodoBird 7. DodoBird Lv 1 30 pts. 11,321
  8. Avatar for silent gene 8. silent gene Lv 1 24 pts. 11,318
  9. Avatar for LociOiling 9. LociOiling Lv 1 19 pts. 11,276
  10. Avatar for smilingone 10. smilingone Lv 1 15 pts. 11,262

Comments