Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for reefyrob 11. reefyrob Lv 1 11 pts. 11,262
  2. Avatar for Galaxie 12. Galaxie Lv 1 9 pts. 11,232
  3. Avatar for jausmh 13. jausmh Lv 1 7 pts. 11,230
  4. Avatar for georg137 14. georg137 Lv 1 5 pts. 11,201
  5. Avatar for robgee 15. robgee Lv 1 4 pts. 11,194
  6. Avatar for phi16 16. phi16 Lv 1 3 pts. 11,192
  7. Avatar for lamoille 17. lamoille Lv 1 2 pts. 11,190
  8. Avatar for LagMasterSam 18. LagMasterSam Lv 1 1 pt. 11,178
  9. Avatar for jamiexq 19. jamiexq Lv 1 1 pt. 11,140
  10. Avatar for Sissue 20. Sissue Lv 1 1 pt. 11,140

Comments