Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups


  1. Avatar for Go Science 100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019

  1. Avatar for ZeroLeak7IRC
    1. ZeroLeak7IRC Lv 1
    100 pts. 11,354
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 97 pts. 11,310
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 11,267
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 92 pts. 11,230
  5. Avatar for frood66 5. frood66 Lv 1 89 pts. 11,228
  6. Avatar for Mark- 6. Mark- Lv 1 86 pts. 11,208
  7. Avatar for Susume 7. Susume Lv 1 83 pts. 11,203
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 81 pts. 11,195
  9. Avatar for LociOiling 9. LociOiling Lv 1 78 pts. 11,184
  10. Avatar for isaksson 10. isaksson Lv 1 76 pts. 11,183

Comments