Placeholder image of a protein
Icon representing a puzzle

1624: Revisiting Puzzle 94: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,500
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 9,213
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,125
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,105
  5. Avatar for freefolder 15. freefolder 1 pt. 8,423
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 8,138
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 8,068
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,397
  1. Avatar for tyler0911
    1. tyler0911 Lv 1
    100 pts. 10,607
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 97 pts. 10,516
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 10,455
  4. Avatar for Aubade01 4. Aubade01 Lv 1 91 pts. 10,440
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 88 pts. 10,392
  6. Avatar for fiendish_ghoul 6. fiendish_ghoul Lv 1 85 pts. 10,361
  7. Avatar for frood66 7. frood66 Lv 1 83 pts. 10,308
  8. Avatar for actiasluna 8. actiasluna Lv 1 80 pts. 10,307
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 77 pts. 10,280
  10. Avatar for Mark- 10. Mark- Lv 1 75 pts. 10,270

Comments

Bletchley Park Lv 1

Thank you for sharing Loci, but what is the point of revisiting these puzzles if the structure is known, previous solutions are shown and a script is given that you can load, enter a parameter in and start ?
I thought the purpose was to see if players can solve the structure all by themselves without prior knowledge ?

tyler0911 Lv 1

My understanding is that these Revisiting puzzles are primarily intended to gauge how much Foldit's new tools have improved players' ability to generate more accurate solutions. Bridge Wiggle is definitely a useful tool, but it's not always the best way to assemble bridges IMO and I don't think it takes away from the goal of puzzles like 1624. In this case, I did not use Bridge Wiggle for my current high score on 1624 because doing so caused the cysteine residues to score poorly in my other attempts

frood66 Lv 1

I take on board both the comments above.

Then I have a nasty word for some - laziness.

I fear this is the way foldit has been going for a long time.

Sorry if that sounds harsh.