1624: Revisiting Puzzle 94: Mouse
Closed since about 7 years ago
Novice Overall PredictionSummary
- Created
- January 16, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Top groups
-
100 pts. 10,616
-
-
-
-
-
-
-
-
-
-
1. Galaxie Lv 1100 pts. 10,616 -
-
-
-
-
-
-
-
-
Comments
Bletchley Park Lv 1
Thank you for sharing Loci, but what is the point of revisiting these puzzles if the structure is known, previous solutions are shown and a script is given that you can load, enter a parameter in and start ?
I thought the purpose was to see if players can solve the structure all by themselves without prior knowledge ?
tyler0911 Lv 1
My understanding is that these Revisiting puzzles are primarily intended to gauge how much Foldit's new tools have improved players' ability to generate more accurate solutions. Bridge Wiggle is definitely a useful tool, but it's not always the best way to assemble bridges IMO and I don't think it takes away from the goal of puzzles like 1624. In this case, I did not use Bridge Wiggle for my current high score on 1624 because doing so caused the cysteine residues to score poorly in my other attempts
frood66 Lv 1
I take on board both the comments above.
Then I have a nasty word for some - laziness.
I fear this is the way foldit has been going for a long time.
Sorry if that sounds harsh.