Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734

  1. Avatar for tyler0911
    1. tyler0911 Lv 1
    100 pts. 10,854
  2. Avatar for crpainter 2. crpainter Lv 1 97 pts. 10,824
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 10,759
  4. Avatar for smilingone 4. smilingone Lv 1 91 pts. 10,752
  5. Avatar for Deleted player 5. Deleted player 88 pts. 10,715
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 86 pts. 10,708
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 83 pts. 10,687
  8. Avatar for robgee 8. robgee Lv 1 80 pts. 10,680
  9. Avatar for Phyx 9. Phyx Lv 1 78 pts. 10,678
  10. Avatar for LociOiling 10. LociOiling Lv 1 75 pts. 10,677

Comments