Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,897
  2. Avatar for robgee 2. robgee Lv 1 87 pts. 10,824
  3. Avatar for gdnskye 3. gdnskye Lv 1 76 pts. 10,817
  4. Avatar for lamoille 4. lamoille Lv 1 65 pts. 10,812
  5. Avatar for phi16 5. phi16 Lv 1 56 pts. 10,809
  6. Avatar for jamiexq 6. jamiexq Lv 1 48 pts. 10,805
  7. Avatar for alwen 7. alwen Lv 1 41 pts. 10,803
  8. Avatar for tyler0911 8. tyler0911 Lv 1 34 pts. 10,796
  9. Avatar for Deleted player 9. Deleted player 29 pts. 10,756
  10. Avatar for LociOiling 10. LociOiling Lv 1 24 pts. 10,754

Comments