Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,897
  2. Avatar for Contenders 2. Contenders 77 pts. 10,824
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,756
  4. Avatar for Go Science 4. Go Science 43 pts. 10,711
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,687
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,624
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,614
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,605
  9. Avatar for Hold My Beer 9. Hold My Beer 7 pts. 10,595
  10. Avatar for Russian team 10. Russian team 5 pts. 10,538
  1. Avatar for smilingone 11. smilingone Lv 1 20 pts. 10,752
  2. Avatar for alcor29 12. alcor29 Lv 1 17 pts. 10,743
  3. Avatar for reefyrob 13. reefyrob Lv 1 14 pts. 10,742
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 11 pts. 10,711
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 9 pts. 10,711
  6. Avatar for Phyx 16. Phyx Lv 1 7 pts. 10,711
  7. Avatar for Hollinas 17. Hollinas Lv 1 6 pts. 10,709
  8. Avatar for silent gene 18. silent gene Lv 1 5 pts. 10,698
  9. Avatar for isaksson 19. isaksson Lv 1 4 pts. 10,633
  10. Avatar for retiredmichael 20. retiredmichael Lv 1 3 pts. 10,625

Comments