Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,897
  2. Avatar for Contenders 2. Contenders 77 pts. 10,824
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,756
  4. Avatar for Go Science 4. Go Science 43 pts. 10,711
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,687
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,624
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,614
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,605
  9. Avatar for Hold My Beer 9. Hold My Beer 7 pts. 10,595
  10. Avatar for Russian team 10. Russian team 5 pts. 10,538
  1. Avatar for doctaven 141. doctaven Lv 1 1 pt. 9,158
  2. Avatar for KAOSkonfused 142. KAOSkonfused Lv 1 1 pt. 9,138
  3. Avatar for camcam0314 143. camcam0314 Lv 1 1 pt. 9,122
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 9,085
  5. Avatar for DaggerBall 145. DaggerBall Lv 1 1 pt. 9,041
  6. Avatar for blee2 146. blee2 Lv 1 1 pt. 8,992
  7. Avatar for Gleb Ptitsyn 147. Gleb Ptitsyn Lv 1 1 pt. 8,976
  8. Avatar for SmallHummingBird 148. SmallHummingBird Lv 1 1 pt. 8,942
  9. Avatar for Fowardint 149. Fowardint Lv 1 1 pt. 8,907
  10. Avatar for Dword 150. Dword Lv 1 1 pt. 8,693

Comments