Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,897
  2. Avatar for Contenders 2. Contenders 77 pts. 10,824
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,756
  4. Avatar for Go Science 4. Go Science 43 pts. 10,711
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,687
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,624
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,614
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,605
  9. Avatar for Hold My Beer 9. Hold My Beer 7 pts. 10,595
  10. Avatar for Russian team 10. Russian team 5 pts. 10,538

  1. Avatar for gdnskye 11. gdnskye Lv 1 73 pts. 10,662
  2. Avatar for Aubade01 12. Aubade01 Lv 1 70 pts. 10,660
  3. Avatar for ZeroLeak7 13. ZeroLeak7 Lv 1 68 pts. 10,659
  4. Avatar for fpc 14. fpc Lv 1 66 pts. 10,653
  5. Avatar for grogar7 15. grogar7 Lv 1 63 pts. 10,652
  6. Avatar for Marvelz 16. Marvelz Lv 1 61 pts. 10,636
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 59 pts. 10,631
  8. Avatar for jausmh 18. jausmh Lv 1 57 pts. 10,624
  9. Avatar for actiasluna 19. actiasluna Lv 1 55 pts. 10,614
  10. Avatar for nicobul 20. nicobul Lv 1 53 pts. 10,605

Comments