Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,897
  2. Avatar for Contenders 2. Contenders 77 pts. 10,824
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,756
  4. Avatar for Go Science 4. Go Science 43 pts. 10,711
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,687
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,624
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,614
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,605
  9. Avatar for Hold My Beer 9. Hold My Beer 7 pts. 10,595
  10. Avatar for Russian team 10. Russian team 5 pts. 10,538
  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 6 pts. 10,116
  2. Avatar for RyeSnake 72. RyeSnake Lv 1 6 pts. 10,113
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 5 pts. 10,091
  4. Avatar for pfeiffelfloyd 74. pfeiffelfloyd Lv 1 5 pts. 10,058
  5. Avatar for rezaefar 75. rezaefar Lv 1 5 pts. 10,054
  6. Avatar for WBarme1234 76. WBarme1234 Lv 1 5 pts. 10,035
  7. Avatar for stomjoh 77. stomjoh Lv 1 4 pts. 10,019
  8. Avatar for hansvandenhof 78. hansvandenhof Lv 1 4 pts. 10,015
  9. Avatar for Altercomp 79. Altercomp Lv 1 4 pts. 9,951
  10. Avatar for isaksson 80. isaksson Lv 1 4 pts. 9,950

Comments