Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,211
  2. Avatar for Deleted player 2. Deleted player 84 pts. 10,210
  3. Avatar for gdnskye 3. gdnskye Lv 1 70 pts. 10,205
  4. Avatar for LociOiling 4. LociOiling Lv 1 57 pts. 10,205
  5. Avatar for lamoille 5. lamoille Lv 1 47 pts. 10,202
  6. Avatar for smilingone 6. smilingone Lv 1 38 pts. 10,202
  7. Avatar for tyler0911 7. tyler0911 Lv 1 30 pts. 10,197
  8. Avatar for robgee 8. robgee Lv 1 24 pts. 10,197
  9. Avatar for alwen 9. alwen Lv 1 19 pts. 10,190
  10. Avatar for reefyrob 10. reefyrob Lv 1 15 pts. 10,190

Comments