Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 10,226
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 10,167
  3. Avatar for reefyrob 3. reefyrob Lv 1 95 pts. 10,160
  4. Avatar for grogar7 4. grogar7 Lv 1 92 pts. 10,144
  5. Avatar for tyler0911 5. tyler0911 Lv 1 89 pts. 10,108
  6. Avatar for jobo0502 6. jobo0502 Lv 1 86 pts. 10,099
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 84 pts. 10,098
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 81 pts. 10,094
  9. Avatar for johnmitch 9. johnmitch Lv 1 79 pts. 10,085
  10. Avatar for LociOiling 10. LociOiling Lv 1 76 pts. 10,056

Comments