Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,313
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  10. Avatar for BIOF215 20. BIOF215 1 pt. 8,082
  1. Avatar for Auntecedent 121. Auntecedent Lv 1 1 pt. 8,552
  2. Avatar for mikim2018 122. mikim2018 Lv 1 1 pt. 8,534
  3. Avatar for oureion 123. oureion Lv 1 1 pt. 8,521
  4. Avatar for ViJay7019 124. ViJay7019 Lv 1 1 pt. 8,494
  5. Avatar for lamoille 125. lamoille Lv 1 1 pt. 8,493
  6. Avatar for Simek 126. Simek Lv 1 1 pt. 8,485
  7. Avatar for utils 127. utils Lv 1 1 pt. 8,471
  8. Avatar for srrao2019 128. srrao2019 Lv 1 1 pt. 8,470
  9. Avatar for Knoblerine 129. Knoblerine Lv 1 1 pt. 8,463
  10. Avatar for Kurtis Anderson 130. Kurtis Anderson Lv 1 1 pt. 8,457

Comments