Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,313
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  10. Avatar for BIOF215 20. BIOF215 1 pt. 8,082
  1. Avatar for C o n s u m e 151. C o n s u m e Lv 1 1 pt. 8,157
  2. Avatar for Agent19 152. Agent19 Lv 1 1 pt. 8,156
  3. Avatar for thel0lminecrafter 153. thel0lminecrafter Lv 1 1 pt. 8,155
  4. Avatar for PlagueRat 154. PlagueRat Lv 1 1 pt. 8,112
  5. Avatar for peanutbutterwithhoney 155. peanutbutterwithhoney Lv 1 1 pt. 8,097
  6. Avatar for timusinv 156. timusinv Lv 1 1 pt. 8,082
  7. Avatar for Steven Pletsch 157. Steven Pletsch Lv 1 1 pt. 8,072
  8. Avatar for wisky 158. wisky Lv 1 1 pt. 8,062
  9. Avatar for Willyanto 159. Willyanto Lv 1 1 pt. 8,057
  10. Avatar for ti_go_Mars 160. ti_go_Mars Lv 1 1 pt. 8,027

Comments