Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,313
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  10. Avatar for BIOF215 20. BIOF215 1 pt. 8,082
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 74 pts. 10,042
  2. Avatar for frood66 12. frood66 Lv 1 71 pts. 10,039
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 69 pts. 10,011
  4. Avatar for Galaxie 14. Galaxie Lv 1 67 pts. 9,989
  5. Avatar for Mark- 15. Mark- Lv 1 65 pts. 9,985
  6. Avatar for phi16 16. phi16 Lv 1 63 pts. 9,982
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 61 pts. 9,946
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 59 pts. 9,944
  9. Avatar for gdnskye 19. gdnskye Lv 1 57 pts. 9,942
  10. Avatar for Phyx 20. Phyx Lv 1 55 pts. 9,936

Comments