Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for Skippysk8s 41. Skippysk8s Lv 1 26 pts. 9,789
  2. Avatar for Vinara 42. Vinara Lv 1 25 pts. 9,763
  3. Avatar for jamiexq 43. jamiexq Lv 1 24 pts. 9,760
  4. Avatar for nicobul 44. nicobul Lv 1 23 pts. 9,754
  5. Avatar for isaksson 45. isaksson Lv 1 22 pts. 9,727
  6. Avatar for tarimo 46. tarimo Lv 1 21 pts. 9,726
  7. Avatar for alcor29 47. alcor29 Lv 1 20 pts. 9,709
  8. Avatar for diamonddays 48. diamonddays Lv 1 19 pts. 9,668
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 19 pts. 9,665
  10. Avatar for MicElephant 50. MicElephant Lv 1 18 pts. 9,660

Comments