Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for cbwest 61. cbwest Lv 1 11 pts. 9,369
  2. Avatar for crpainter 62. crpainter Lv 1 11 pts. 9,336
  3. Avatar for georg137 63. georg137 Lv 1 10 pts. 9,316
  4. Avatar for @lison 64. @lison Lv 1 10 pts. 9,267
  5. Avatar for Merf 65. Merf Lv 1 9 pts. 9,249
  6. Avatar for lensman3 67. lensman3 Lv 1 8 pts. 9,207
  7. Avatar for Artoria2e5 68. Artoria2e5 Lv 1 8 pts. 9,204
  8. Avatar for heather-1 69. heather-1 Lv 1 8 pts. 9,182
  9. Avatar for WBarme1234 70. WBarme1234 Lv 1 7 pts. 9,178

Comments