Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 4 pts. 9,024
  2. Avatar for kvasirthewise 82. kvasirthewise Lv 1 4 pts. 8,997
  3. Avatar for TePie 83. TePie Lv 1 4 pts. 8,992
  4. Avatar for vizhu2018 84. vizhu2018 Lv 1 4 pts. 8,987
  5. Avatar for harvardman 85. harvardman Lv 1 3 pts. 8,986
  6. Avatar for Vincera 86. Vincera Lv 1 3 pts. 8,972
  7. Avatar for andromeda72 87. andromeda72 Lv 1 3 pts. 8,958
  8. Avatar for Squirrely 88. Squirrely Lv 1 3 pts. 8,954
  9. Avatar for carsonfb 89. carsonfb Lv 1 3 pts. 8,951
  10. Avatar for frostschutz 90. frostschutz Lv 1 3 pts. 8,930

Comments