Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129
  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 10,226
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 10,167
  3. Avatar for reefyrob 3. reefyrob Lv 1 95 pts. 10,160
  4. Avatar for grogar7 4. grogar7 Lv 1 92 pts. 10,144
  5. Avatar for tyler0911 5. tyler0911 Lv 1 89 pts. 10,108
  6. Avatar for jobo0502 6. jobo0502 Lv 1 86 pts. 10,099
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 84 pts. 10,098
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 81 pts. 10,094
  9. Avatar for johnmitch 9. johnmitch Lv 1 79 pts. 10,085
  10. Avatar for LociOiling 10. LociOiling Lv 1 76 pts. 10,056

Comments