Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811

  1. Avatar for katling 141. katling Lv 1 1 pt. 8,316
  2. Avatar for nathanmills 142. nathanmills Lv 1 1 pt. 8,313
  3. Avatar for Sydefecks 143. Sydefecks Lv 1 1 pt. 8,268
  4. Avatar for jhat 144. jhat Lv 1 1 pt. 8,257
  5. Avatar for smais 145. smais Lv 1 1 pt. 8,247
  6. Avatar for legotankman 146. legotankman Lv 1 1 pt. 8,241
  7. Avatar for Snipemebud 147. Snipemebud Lv 1 1 pt. 8,183
  8. Avatar for maur9357 148. maur9357 Lv 1 1 pt. 8,183
  9. Avatar for SonofNolan 149. SonofNolan Lv 1 1 pt. 8,161
  10. Avatar for doctaven 150. doctaven Lv 1 1 pt. 8,160

Comments