Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811

  1. Avatar for 181818 51. 181818 Lv 1 17 pts. 9,621
  2. Avatar for altejoh 52. altejoh Lv 1 16 pts. 9,595
  3. Avatar for Aminal88 53. Aminal88 Lv 1 16 pts. 9,572
  4. Avatar for Sissue 54. Sissue Lv 1 15 pts. 9,538
  5. Avatar for orily1337 55. orily1337 Lv 1 14 pts. 9,518
  6. Avatar for alwen 56. alwen Lv 1 14 pts. 9,516
  7. Avatar for Jesse Pinkman 57. Jesse Pinkman Lv 1 13 pts. 9,487
  8. Avatar for silent gene 58. silent gene Lv 1 13 pts. 9,483
  9. Avatar for MrZanav 59. MrZanav Lv 1 12 pts. 9,453
  10. Avatar for Hellcat6 60. Hellcat6 Lv 1 12 pts. 9,414

Comments