Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,253
  2. Avatar for gdnskye 2. gdnskye Lv 1 80 pts. 9,247
  3. Avatar for phi16 3. phi16 Lv 1 63 pts. 9,239
  4. Avatar for jamiexq 4. jamiexq Lv 1 49 pts. 9,237
  5. Avatar for lamoille 5. lamoille Lv 1 37 pts. 9,236
  6. Avatar for robgee 6. robgee Lv 1 28 pts. 9,236
  7. Avatar for tyler0911 7. tyler0911 Lv 1 21 pts. 9,235
  8. Avatar for alcor29 8. alcor29 Lv 1 15 pts. 9,232
  9. Avatar for alwen 9. alwen Lv 1 11 pts. 9,226
  10. Avatar for LociOiling 10. LociOiling Lv 1 8 pts. 9,180

Comments