Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,253
  2. Avatar for HMT heritage 2. HMT heritage 80 pts. 9,225
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,180
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,171
  5. Avatar for Go Science 5. Go Science 37 pts. 9,161
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,111
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,057
  8. Avatar for Marvin's bunch 8. Marvin's bunch 15 pts. 9,052
  9. Avatar for Russian team 9. Russian team 11 pts. 9,006
  10. Avatar for Contenders 10. Contenders 8 pts. 8,972

  1. Avatar for Galaxie 11. Galaxie Lv 1 73 pts. 9,154
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 71 pts. 9,135
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 68 pts. 9,133
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 66 pts. 9,118
  5. Avatar for Phyx 15. Phyx Lv 1 64 pts. 9,118
  6. Avatar for nicobul 16. nicobul Lv 1 62 pts. 9,111
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 60 pts. 9,109
  8. Avatar for reefyrob 18. reefyrob Lv 1 58 pts. 9,092
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 56 pts. 9,090
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 54 pts. 9,078

Comments