Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,253
  2. Avatar for HMT heritage 2. HMT heritage 80 pts. 9,225
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,180
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,171
  5. Avatar for Go Science 5. Go Science 37 pts. 9,161
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,111
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,057
  8. Avatar for Marvin's bunch 8. Marvin's bunch 15 pts. 9,052
  9. Avatar for Russian team 9. Russian team 11 pts. 9,006
  10. Avatar for Contenders 10. Contenders 8 pts. 8,972
  1. Avatar for grogar7 21. grogar7 Lv 1 52 pts. 9,075
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 50 pts. 9,057
  3. Avatar for orily1337 23. orily1337 Lv 1 48 pts. 9,052
  4. Avatar for DodoBird 24. DodoBird Lv 1 47 pts. 9,052
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 45 pts. 9,043
  6. Avatar for fpc 26. fpc Lv 1 43 pts. 9,032
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 42 pts. 9,030
  8. Avatar for vakobo 28. vakobo Lv 1 40 pts. 9,006
  9. Avatar for Deleted player 29. Deleted player 39 pts. 9,004
  10. Avatar for jausmh 30. jausmh Lv 1 37 pts. 8,996

Comments