Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 10,630
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,550
  3. Avatar for smilingone 3. smilingone Lv 1 94 pts. 10,495
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 91 pts. 10,483
  5. Avatar for tyler0911 5. tyler0911 Lv 1 88 pts. 10,483
  6. Avatar for Galaxie 6. Galaxie Lv 1 86 pts. 10,473
  7. Avatar for grogar7 7. grogar7 Lv 1 83 pts. 10,446
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 80 pts. 10,403
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 78 pts. 10,396
  10. Avatar for actiasluna 10. actiasluna Lv 1 75 pts. 10,390

Comments