Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,550
  2. Avatar for Deleted player 2. Deleted player 81 pts. 10,549
  3. Avatar for smilingone 3. smilingone Lv 1 64 pts. 10,545
  4. Avatar for reefyrob 4. reefyrob Lv 1 50 pts. 10,514
  5. Avatar for Galaxie 5. Galaxie Lv 1 39 pts. 10,495
  6. Avatar for silent gene 6. silent gene Lv 1 30 pts. 10,482
  7. Avatar for Phyx 7. Phyx Lv 1 23 pts. 10,472
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 17 pts. 10,470
  9. Avatar for gdnskye 9. gdnskye Lv 1 12 pts. 10,466
  10. Avatar for robgee 10. robgee Lv 1 9 pts. 10,463

Comments