Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,122

  1. Avatar for vakobo 11. vakobo Lv 1 73 pts. 10,347
  2. Avatar for O Seki To 12. O Seki To Lv 1 70 pts. 10,335
  3. Avatar for gdnskye 13. gdnskye Lv 1 68 pts. 10,332
  4. Avatar for johnmitch 14. johnmitch Lv 1 66 pts. 10,327
  5. Avatar for fpc 15. fpc Lv 1 63 pts. 10,325
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 61 pts. 10,324
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 59 pts. 10,324
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 57 pts. 10,319
  9. Avatar for MicElephant 19. MicElephant Lv 1 55 pts. 10,311
  10. Avatar for crpainter 20. crpainter Lv 1 53 pts. 10,308

Comments