Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for tarimo 31. tarimo Lv 1 35 pts. 10,185
  2. Avatar for aznarog 32. aznarog Lv 1 34 pts. 10,182
  3. Avatar for Norrjane 33. Norrjane Lv 1 33 pts. 10,175
  4. Avatar for Alistair69 34. Alistair69 Lv 1 31 pts. 10,170
  5. Avatar for frood66 35. frood66 Lv 1 30 pts. 10,160
  6. Avatar for jamiexq 36. jamiexq Lv 1 29 pts. 10,152
  7. Avatar for Sissue 37. Sissue Lv 1 28 pts. 10,145
  8. Avatar for Merf 38. Merf Lv 1 27 pts. 10,138
  9. Avatar for Deleted player 39. Deleted player 26 pts. 10,129
  10. Avatar for orily1337 40. orily1337 Lv 1 25 pts. 10,115

Comments