Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for Phyx 41. Phyx Lv 1 24 pts. 10,111
  2. Avatar for isaksson 42. isaksson Lv 1 23 pts. 10,105
  3. Avatar for diamonddays 43. diamonddays Lv 1 22 pts. 10,099
  4. Avatar for RockOn 44. RockOn Lv 1 21 pts. 10,083
  5. Avatar for Marvelz 45. Marvelz Lv 1 20 pts. 10,075
  6. Avatar for guineapig 46. guineapig Lv 1 19 pts. 10,071
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 18 pts. 10,070
  8. Avatar for cbwest 48. cbwest Lv 1 18 pts. 10,069
  9. Avatar for dcrwheeler 49. dcrwheeler Lv 1 17 pts. 10,067
  10. Avatar for Blipperman 50. Blipperman Lv 1 16 pts. 10,063

Comments