Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for andromeda72 61. andromeda72 Lv 1 10 pts. 9,954
  2. Avatar for YeshuaLives 62. YeshuaLives Lv 1 9 pts. 9,939
  3. Avatar for Deleted player 63. Deleted player pts. 9,918
  4. Avatar for nicobul 64. nicobul Lv 1 8 pts. 9,910
  5. Avatar for joremen 65. joremen Lv 1 8 pts. 9,907
  6. Avatar for altejoh 66. altejoh Lv 1 8 pts. 9,905
  7. Avatar for Arne Heessels 67. Arne Heessels Lv 1 7 pts. 9,903
  8. Avatar for Simek 68. Simek Lv 1 7 pts. 9,853
  9. Avatar for ironchefnorse 69. ironchefnorse Lv 1 6 pts. 9,845
  10. Avatar for Flagg65a 70. Flagg65a Lv 1 6 pts. 9,841

Comments