Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233

  1. Avatar for Lyshi2018 101. Lyshi2018 Lv 1 1 pt. 9,382
  2. Avatar for Silvercraft 102. Silvercraft Lv 1 1 pt. 9,373
  3. Avatar for Squirrely 103. Squirrely Lv 1 1 pt. 9,359
  4. Avatar for vizhu2018 104. vizhu2018 Lv 1 1 pt. 9,334
  5. Avatar for ourtown 105. ourtown Lv 1 1 pt. 9,326
  6. Avatar for boondog 106. boondog Lv 1 1 pt. 9,294
  7. Avatar for ViJay7019 107. ViJay7019 Lv 1 1 pt. 9,249
  8. Avatar for benz888 108. benz888 Lv 1 1 pt. 9,229
  9. Avatar for ManVsYard 109. ManVsYard Lv 1 1 pt. 9,201
  10. Avatar for Poovent 110. Poovent Lv 1 1 pt. 9,183

Comments