Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233

  1. Avatar for vakobo 11. vakobo Lv 1 73 pts. 10,347
  2. Avatar for O Seki To 12. O Seki To Lv 1 70 pts. 10,335
  3. Avatar for gdnskye 13. gdnskye Lv 1 68 pts. 10,332
  4. Avatar for johnmitch 14. johnmitch Lv 1 66 pts. 10,327
  5. Avatar for fpc 15. fpc Lv 1 63 pts. 10,325
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 61 pts. 10,324
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 59 pts. 10,324
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 57 pts. 10,319
  9. Avatar for MicElephant 19. MicElephant Lv 1 55 pts. 10,311
  10. Avatar for crpainter 20. crpainter Lv 1 53 pts. 10,308

Comments