Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233

  1. Avatar for tarimo 31. tarimo Lv 1 35 pts. 10,185
  2. Avatar for aznarog 32. aznarog Lv 1 34 pts. 10,182
  3. Avatar for Norrjane 33. Norrjane Lv 1 33 pts. 10,175
  4. Avatar for Alistair69 34. Alistair69 Lv 1 31 pts. 10,170
  5. Avatar for frood66 35. frood66 Lv 1 30 pts. 10,160
  6. Avatar for jamiexq 36. jamiexq Lv 1 29 pts. 10,152
  7. Avatar for Sissue 37. Sissue Lv 1 28 pts. 10,145
  8. Avatar for Merf 38. Merf Lv 1 27 pts. 10,138
  9. Avatar for Deleted player 39. Deleted player 26 pts. 10,129
  10. Avatar for orily1337 40. orily1337 Lv 1 25 pts. 10,115

Comments