1639: Revisiting Puzzle 110: Turkey
Closed since about 7 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- February 20, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK