Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233

  1. Avatar for andromeda72 61. andromeda72 Lv 1 10 pts. 9,954
  2. Avatar for YeshuaLives 62. YeshuaLives Lv 1 9 pts. 9,939
  3. Avatar for Deleted player 63. Deleted player pts. 9,918
  4. Avatar for nicobul 64. nicobul Lv 1 8 pts. 9,910
  5. Avatar for joremen 65. joremen Lv 1 8 pts. 9,907
  6. Avatar for altejoh 66. altejoh Lv 1 8 pts. 9,905
  7. Avatar for Arne Heessels 67. Arne Heessels Lv 1 7 pts. 9,903
  8. Avatar for Simek 68. Simek Lv 1 7 pts. 9,853
  9. Avatar for ironchefnorse 69. ironchefnorse Lv 1 6 pts. 9,845
  10. Avatar for Flagg65a 70. Flagg65a Lv 1 6 pts. 9,841

Comments