Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,174
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,532
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,346
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,973
  5. Avatar for DW 2020 15. DW 2020 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,540
  7. Avatar for Deleted group 17. Deleted group pts. 5,503
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 0
  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 10,937
  2. Avatar for jermainiac 2. jermainiac Lv 1 96 pts. 10,403
  3. Avatar for Galaxie 3. Galaxie Lv 1 93 pts. 10,346
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 89 pts. 10,321
  5. Avatar for actiasluna 5. actiasluna Lv 1 85 pts. 10,279
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 82 pts. 10,273
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 78 pts. 10,272
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 75 pts. 10,222
  9. Avatar for robgee 9. robgee Lv 1 72 pts. 10,113
  10. Avatar for Vinara 10. Vinara Lv 1 69 pts. 9,961

Comments