Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,434
  2. Avatar for jermainiac 2. jermainiac Lv 1 84 pts. 10,417
  3. Avatar for Deleted player 3. Deleted player pts. 10,361
  4. Avatar for phi16 4. phi16 Lv 1 57 pts. 10,338
  5. Avatar for lamoille 5. lamoille Lv 1 47 pts. 10,336
  6. Avatar for jamiexq 6. jamiexq Lv 1 38 pts. 10,335
  7. Avatar for robgee 7. robgee Lv 1 30 pts. 10,334
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 24 pts. 10,322
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 19 pts. 10,320
  10. Avatar for Hollinas 10. Hollinas Lv 1 15 pts. 10,320

Comments