Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386

  1. Avatar for vakobo 21. vakobo Lv 1 41 pts. 9,741
  2. Avatar for grogar7 22. grogar7 Lv 1 39 pts. 9,658
  3. Avatar for alcor29 23. alcor29 Lv 1 37 pts. 9,637
  4. Avatar for georg137 24. georg137 Lv 1 36 pts. 9,622
  5. Avatar for Deleted player 25. Deleted player pts. 9,597
  6. Avatar for silent gene 26. silent gene Lv 1 32 pts. 9,595
  7. Avatar for phi16 27. phi16 Lv 1 31 pts. 9,589
  8. Avatar for pvc78 28. pvc78 Lv 1 29 pts. 9,554
  9. Avatar for tarimo 29. tarimo Lv 1 28 pts. 9,550
  10. Avatar for jobo0502 30. jobo0502 Lv 1 26 pts. 9,537

Comments